SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D3GWI4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D3GWI4
Domain Number 1 Region: 68-118
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000017
Family B3 DNA binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D3GWI4
Sequence length 195
Comment (tr|A0A0D3GWI4|A0A0D3GWI4_9ORYZ) Uncharacterized protein {ECO:0000313|EnsemblPlants:OBART08G03440.1} KW=Complete proteome; Reference proteome OX=65489 OS=Oryza barthii. GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MYMDLTLGGALLQVEEATEEEEEEEEEEQVLGQEPAPAAAAAALVLGRRHGVVVGGGGGG
VVVAAEREHMFDKVVTPSDVGKLNRLVVPKQHAERFFPAAAAGTQLCFEDRAGTPWRAAT
ATMFLDTVAPVAAAGGHRGEVGPSGQRSFRLFGVNVECGGDVDAAAEEEDADDDVDDGDH
RRGEEMELVMWTNHR
Download sequence
Identical sequences A0A0D3GWI4
OBART08G03440.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]