SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D5BDV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D5BDV6
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Bacterial photosystem II reaction centre, L and M subunits 3.79e-40
Family Bacterial photosystem II reaction centre, L and M subunits 0.00000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D5BDV6
Sequence length 115
Comment (tr|A0A0D5BDV6|A0A0D5BDV6_9DIPS) PsbA {ECO:0000313|EMBL:AJW59409.1} OX=1112105 OS=Zabelia dielsii. GN=psbA OC=Zabelia.
Sequence
FGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLN
GFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAALEAPSTNG
Download sequence
Identical sequences A0A0D5BDP8 A0A0D5BDV6 A0A0D5BED5 A0A0D5BEE1 A0A0D5BEE6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]