SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D5CE15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D5CE15
Domain Number 1 Region: 1-190
Classification Level Classification E-value
Superfamily Bacterial photosystem II reaction centre, L and M subunits 4.06e-89
Family Bacterial photosystem II reaction centre, L and M subunits 0.00000000872
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D5CE15
Sequence length 190
Comment (tr|A0A0D5CE15|A0A0D5CE15_9EUKA) Photosystem II protein D1 {ECO:0000313|EMBL:AJW77570.1} OX=1631190 OS=Phaeocystis rex RA-2015b. GN=psbA OC=Eukaryota; Haptophyceae; Phaeocystales; Phaeocystaceae; Phaeocystis.
Sequence
YPIWEAASIDEWLYNGGPYQLVVFHFFIGVCAYIGREWELSYRLGMRPWICVAFSAPVAA
AAAVFVIYPIGQGSFSDGMPLGISGTFNFMLVFQAEHNILMHPFHMLGVAGVFGGSLFSA
MHGSLVTSSLIRETTENESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRALHF
FLGAWPVVGI
Download sequence
Identical sequences A0A0D5CD68 A0A0D5CE15 A0A0D5CE52 A0A0D5CE77

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]