SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D5N594 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D5N594
Domain Number 1 Region: 5-187
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.66e-54
Family Methylesterase CheB, C-terminal domain 0.0000351
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D5N594
Sequence length 189
Comment (tr|A0A0D5N594|A0A0D5N594_GEOSN) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome OX=35554 OS=Geobacter sulfurreducens. GN=RW64_05110 OC=Geobacteraceae; Geobacter.
Sequence
MFNGNIVVIGVSTGGPITLKTLFSTLPRLEAAVIVVLHIQPGMDERVALSLAKVSVMPVN
LAKDGEYLRTGHVYLAPGGCHLALEGNRRIMLVSGPRVNYVQPSADVTMKSLQRSRSNVF
VGIVLTGMGNDGAEGIRHIKSIGGITIAQDRETSSVYGMPRSAIATGAVDYVLPDVKMGK
LIERLVNGE
Download sequence
Identical sequences A0A0D5N594 I7FIJ8
gi|409913200|ref|YP_006891665.1| WP_010943384.1.53615 WP_010943384.1.88929 YP_006589565.1.89865 gi|400756720|ref|YP_006589565.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]