SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D5VA79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D5VA79
Domain Number 1 Region: 747-999
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.18e-30
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.019
Further Details:      
 
Domain Number 2 Region: 33-218
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.65e-20
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.064
Further Details:      
 
Domain Number 3 Region: 461-648
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.35e-17
Family Pyruvate oxidase and decarboxylase PP module 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D5VA79
Sequence length 1199
Comment (tr|A0A0D5VA79|A0A0D5VA79_9BURK) Uncharacterized protein {ECO:0000313|EMBL:AJZ59058.1} KW=Complete proteome; Reference proteome OX=134537 OS=Paraburkholderia fungorum. GN=OI25_1729 OC=Burkholderiaceae; Paraburkholderia.
Sequence
MNAPLDAGQRASLEAALSSVTLDDKYTLERGRAYMSGIQALVRLPMLQQERDQAAGLNTA
GFISGYRGSPLGGLDQSLWKAKQHLAAHRVVFQPGVNEDLAATAVWGSQQVNLYPSAKYD
GVFSMWYGKGPGVDRSGDVFKHGNSAGSSQHGGVLVLAGDDHAAKSSTLAHQSEHIFKAC
GLPVLFPSNVQEYLDFGLHGWAMSRYSGLWVAMKCVTDVVESSASVDIDPHRTKIILPDD
FAMPEGGLNIRWPDPPLVQEARLLDYKWYAALAYVRANKLDRVEIDSPHARFGIMTGGKA
YLDVRQALTDLGLDDETCSRIGIRLYKVGCVWPLEAQGAHAFARGLQEILVVEEKRQILE
YAIKEELYNWPDAQRPRVFGKFDEKDGAGGEWSVPMGNWLLPAHYELSPAIIAKAIATRL
DKFDLPSDVRARIATRIAVIEAKEKALARPRVEAERKPWFCSGCPHNTSTNVPEGSRAMA
GIGCHYMTVWMDRSTSTFSQMGGEGVAWIGQAPFTNDKHVFANLGDGTYFHSGLLAIRAA
IASKANITYKILYNDAVAMTGGQPVDGVLTVPQITHQLAAEGATKIVIVTDEPEKYSANV
GLVPGIDIHHRDQLDEVQRQLREIPGTTILIYDQTCATEKRRRRKRGTYPDPARRVVINE
AVCEGCGDCSVKSNCLSVEPLDTEFGTKRQINQSTCNKDFSCVNGFCPSFVSVEGGQLRK
PKAASGIVADAMPPVPEPELPSIERPYGVLVTGVGGTGVVTIGALLGMAAHLENKGVTVL
DVTGLAQKGGAVMSHVQIARNPADIHATRIAMGEASLVIGCDAIVTASDECVSRMQAGHT
RVVLNSAHTPTAALIKNPDWRFPGSSTEADVRAGAGDDGVDMVDANHFAVALLGDAIYTN
PFVLGYAWQRGWVPLTYQSLMRAIELNNVQIEKNRAAFEWGRRAAHDLPAVRKLAQSQGR
GAAAETTSNKIISLHTPKALDTLIDKRADYLAAYQNAAYADRYRALVAQVRVAESALDSI
DSQLPLTEAVAKNLHKLMAYKDEYEVARLYSDPAFIEKLNATFEGDWKLHLHLAPPTFSK
KDAKGHLVKKKYGPWMFSAMHMLARLKFLRGTALDPFGKTEERRTERALIGEYEALVREL
IGGLTAQKRELAVELANLPDGIRGYGHVKENNLKGVRVKWNELLTRWRSPEAGKTQHAA
Download sequence
Identical sequences A0A0D5VA79
WP_046567521.1.9204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]