SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D5ZEQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D5ZEQ6
Domain Number 1 Region: 200-459
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.83e-60
Family Pyruvate oxidase and decarboxylase Pyr module 0.041
Further Details:      
 
Domain Number 2 Region: 8-225
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 9.55e-28
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.015
Further Details:      
 
Domain Number 3 Region: 469-575
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.57e-20
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D5ZEQ6
Sequence length 578
Comment (tr|A0A0D5ZEQ6|A0A0D5ZEQ6_9ARCH) 2-oxoacid:ferredoxin oxidoreductase subunit alpha {ECO:0000313|EMBL:AKA48149.1} OX=115547 OS=uncultured archaeon. GN=IX51_02465 OC=Archaea; environmental samples.
Sequence
MAREEAIFRIGGAAGDGVQSAGQIMGKTLSRSGLHVVTYLYYQDIIRGGQSWYQIRGSAN
EIKSQGDGLDILIALNKDALTRHTNPKINEGGASPLQGVAIFDKGISGYEAVDGVTYCAM
PLAEIAAKYGSNKLMKNTVALGAAAAASGLSFDVMSDVIADTFEGKGDVIKQNQDAAKEG
YDYFSQHFKKLEITLKTSNRKRMLMGGGDAVGLGAVMGGLKFYAGYPMTPASSALHFLAS
HASKYGVFVKLPEDEIAAINMAIGGNYAGLRSMTGSSGGGFSLMVEALGMAGMMEVPLVI
YESQRSGPSTGLPTKTEQGDLNLVLGASQGDFPRIVLSPRNVEEMFYMTAEALNLAEKYQ
TPVILMSDLYLSENYATVNDLDLKFKIDHGERAKDNTEDFKRYLDTPTGISPRAIPGQAG
LVHNEDSDEHNEYGDVVSDAVTDPRDRIRAMNKRMRKMETYIKSMTPTPTYKLDGAEYAI
VQWGSTQGVVEEVVDALKEKGHKVGAIEINRPFPMNPDIGKLLEGRKKVIVVEGNYTGQF
NRLLKSEFLVKTELITKYDGENFYPSALAGEIESVIKR
Download sequence
Identical sequences A0A0D5ZEQ6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]