SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D6ACF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6ACF0
Domain Number 1 Region: 71-125
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.00000497
Family GSPII protein E N-terminal domain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D6ACF0
Sequence length 201
Comment (tr|A0A0D6ACF0|A0A0D6ACF0_9CHRO) Uncharacterized protein {ECO:0000313|EMBL:BAQ60462.1} KW=Complete proteome; Reference proteome OX=1615909 OS=Geminocystis sp. NIES-3708. GN=GM3708_868 OC=Chroococcaceae; Geminocystis.
Sequence
MSKNNLINQPIGKILEEAGLINSGQIHVALVEQSIYSHLKLGEILALHGWIDQQTADFFG
HKIKELIVNDHKKQIGNYFFEAGLLKENDIKAILDEQKKLGVKFGSLAVLRGCITQDTLK
FFLKYFASDAKNTNDIQYRDKTTMNLKRTIASENSAKITHPTNSQKQTVNNNNDLTIYER
ITINSYEELEAEGLEDIIWKG
Download sequence
Identical sequences A0A0D6ACF0
WP_066344382.1.75496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]