SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D6E208 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6E208
Domain Number 1 Region: 7-112
Classification Level Classification E-value
Superfamily Homing endonucleases 4.25e-23
Family Group I mobile intron endonuclease 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D6E208
Sequence length 124
Comment (tr|A0A0D6E208|A0A0D6E208_TYDEX) Putative LAGLIDADG homing endonuclease {ECO:0000313|EMBL:CEO91073.1} OX=325645 OS=Tydemania expeditionis (Green alga). GN=orf4 OC=Udoteaceae; Tydemania.
Sequence
MKMILKNIPEKHGYYITGFADGEGSFNVSFRKRNNFLIRWKITPVFNISQDEREILAWIK
HILKCGDKVWVFEVTNQQALNEQILPFFDRFPFQSKKKNFINLKRFVNQILMRRFNKFLF
GEMK
Download sequence
Identical sequences A0A0D6E208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]