SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D6ERP5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6ERP5
Domain Number 1 Region: 557-740
Classification Level Classification E-value
Superfamily MIR domain 2.22e-55
Family MIR domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D6ERP5
Sequence length 965
Comment (tr|A0A0D6ERP5|A0A0D6ERP5_SPOSA) SPOSA6832_04276-mRNA-1:cds {ECO:0000313|EMBL:CEQ42466.1} OX=5005 OS=Sporidiobolus salmonicolor (Sporobolomyces salmonicolor). GN=SPOSA6832_04276 OC=Microbotryomycetes; Sporidiobolales; Sporidiobolaceae; Sporidiobolus.
Sequence
MTFRRPPSPSSSLQVNPVVRAPSSRSRSPSPPSPGWQDPYAPRQPGLPLYTARSHSPNDP
RTPQRDAQMEVVDSSTARRRGGGGALVEGQSSALLEHDSASDTDGRVDKGDKGEKEVWPV
SGIGMEGRIPETRQEFLAKGGGGNGAARGANKWDKLIREPRQRVTWVVHSAGRRGGPCHL
LAAVAPLCDGKCRVLLELTACHSNPQRAVLREALSDLRSQIPLIIYTVLSIITRLYRIGA
NNTVVWDEVSFDLAYEAKQTRLTEAHFGKFGAYYLNRTFYFDVHPPLGKMLVGLSGALAG
FNGSFDFPSGAVYPDHVPFRAMRILLALPGIAMVPLAWGTAVELRMSKWGRHIVTLMVLC
DIAWLVISRFILLDSLLLFFTFTTVYCLACFNNEQRRPFEEDWWIWLTFTGISIGCVASV
KWVGLFVTALVGMYTIEDLWNKFGDLRMSYVSPFSADPEQHCSVLISPFSQRTYARHWVA
RILCLIVIPFCVYALTFKIHFLILNHSGPGDSQMSSLFQAHLRGNDFSQNPLGAPSSSHR
RRKAEPDLAPPTCAEPAFGSRLTLKNMGYGGGLLHSHVQTYPVGSQQQQVTCYHYKDENN
EWIITPTWEADPIDPNGELVYLRHGDQLRLVHAQTGRNLHSHGIAAPVTKLANEVSCYGN
ATIGDSNDYWVVEVVDDFLRGSRHKFDRIHSLSTRLRFRHLNSGCYLRAANAILPQWGFK
QVEVSCDKDDHPKDEHTYWNIESHWNDRLPAGNQKLYRSPFFRDFWHLNVAMMTSNNALV
PDADKEDTIASKPFDWPFLWNGMRMNGWQDFGIKYYLVGNAIVWWMGSASLIVWVFTLLW
HLMRFQRKINDFAPGEWNHFLYLSKIAFGGWAFHYIPFLIMGRVTYLHHYLPTLWFSVLM
VGVLLDHFFFKSRRLTHRTKVGVFAVVASTIVGTFWFFRMCAWGIEGPSKDLWGRQWRQS
WNLHD
Download sequence
Identical sequences A0A0D6ERP5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]