SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D6KD79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6KD79
Domain Number 1 Region: 7-259
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.41e-78
Family PFOR Pyr module 0.0000000445
Further Details:      
 
Domain Number 2 Region: 1030-1252
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.98e-78
Family PFOR PP module 0.000000846
Further Details:      
 
Domain Number 3 Region: 424-677
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.62e-76
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000544
Further Details:      
 
Domain Number 4 Region: 260-420
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.23e-45
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.00000637
Further Details:      
 
Domain Number 5 Region: 806-928
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.2e-41
Family PFOR PP module 0.0000597
Further Details:      
 
Domain Number 6 Region: 674-848
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 4.05e-22
Family Ferredoxin domains from multidomain proteins 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D6KD79
Sequence length 1255
Comment (tr|A0A0D6KD79|A0A0D6KD79_9CYAN) Pyruvate:ferredoxin (Flavodoxin) oxidoreductase {ECO:0000313|EMBL:EKE97400.1} KW=Complete proteome; Reference proteome OX=1188 OS=Tolypothrix sp. PCC 7601. GN=FDUTEX481_05108 OC=Bacteria; Cyanobacteria; Nostocales; Tolypothrichaceae; Tolypothrix.
Sequence
MKTKIFATIDGNEAVAQVAYRVNEVIAIYPITPSSNMAEWSDTWASEGKPNIWGTVPTVV
EMQSEAGVAGAVHGALQTGSLTTTFTASQGLLLMIPNMYKIAGELTPTVFHVSARSLATQ
GLSIFGDHSDVMAARATGFAMLCSASVQEAYDFAAISTRATLESRIPFLHFFDGFRTSHE
VDKVETLSHEDLRSHIPEEFIFAHRARAMTPDRPVLRGTAQNPDVYFQSRETVNPYYLAC
PDITQKAMDEFAKLTGRQYKLFDYHGDPEAERVIVLMGSGCEAVHETVDYLTSLGEKVGV
LKVRLYRPFDTTRFVEALPVTTRNIAVLDRTKEPGASGEPLYLDVVAAIQQSNPKSKIPN
LKSIVGGRYGLSSKEFTPAMIKAVFDNLALAEPKNHFTVGINDDVSHTSLEYDHDFNIEA
DNIVRAIFYGLGADGTVGANKNSIKIIGEETNNYAQGYFVYDSKKSGSVTVSHLRFGPQP
IHSTYLITKANFLACHQWDFIDKFSMLQDIVPGGTFLINSLYSQEEVWQHLPLFVQEQII
QKQLKVYVINGYQVARAAGMAGHINTVMQVCFFALSGVLPKDEAIAAIKKAIRKTYGKKG
DEVVQKNINAVDMALDNLYELNIIPTEQSQSPIPSPPYPISDKAPAFVHDVLGKMIARAG
DDLPVSALPADGTYPTGTAKWEKRNIAKDIPVWDEDVCVQCAKCIMVCPHSAIRGKVYEP
ELLTNAPPTFKSTNPKDRDWHGLQYTLQVAPEDCTGCGVCVDICPAKNKAEPNRKALNMA
AQLPLRDAERENWDFFLSLPNPDRLHLKVSHINQQQMQEPLFEFSGACAGCGETAYVKLA
TQLFGDRMIVANATGCSSIYGGNLPTTPWTTNAEGRGPAWCNSLFEDNAEFGMGFRISLD
KQAEFATELVKQLTPQLGDNLTSSIVNARQKDEADIVEQRERVALLKQRVDELLAAQTPA
GEDEKLHSQGDGVFGHWELGMGHGKEDTNALCPMPQAAGQLSLSTHKGMEFPAAFNEEDA
IARNLKSLKFVADYLVRKSVWIIGGDGWGYDIGFGGLDHVIASGRNVNILILDTEVYSNT
GGQNSKATPRAAIAKFASGGKAAAKKDLGLMAMTYGNVYIASVALGARDEHTLKAFLEAE
AYEGPSIILAYSHCIAHGIDMTTGLHHQKAAVESGEWLLYRYNPDRIKQGENPLQLDSRT
PKLPIEEYMNSENRFKMLTKSHPETAKHLFEEAQADVNTRWQMYQYLASRKLQNR
Download sequence
Identical sequences A0A0D6KD79 A0A1Z4M9H8
WP_045874193.1.57613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]