SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D6LUV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6LUV0
Domain Number 1 Region: 101-240
Classification Level Classification E-value
Superfamily TIMP-like 2.83e-19
Family Tissue inhibitor of metalloproteinases, TIMP 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D6LUV0
Sequence length 249
Comment (tr|A0A0D6LUV0|A0A0D6LUV0_9BILA) Tissue inhibitor of metalloproteinase {ECO:0000313|EMBL:EPB71422.1} OX=53326 OS=Ancylostoma ceylanicum. GN=ANCCEY_09475 OC=Ancylostoma.
Sequence
MPLGRTSSASGSASDGLTSFALGMKVDEDARGRPPSVVDTRQLKEAIEEDPSQTTRELGN
RCRGNFCTKSRWKRLKNKCMNLLQMKVLIILCSSVSIVLSCSCFPQSANEVFCQADWVSR
VKVTSFLNPNNDETGMYDVIYTVNHIRIYKNPTYLLMLPPLVYTPSNGATCGLYMEVGKQ
YLLSATWVITGRMAHFITTSWLSRHLSRSRNSSEAFGGTSQNKRNMGSCVVITKKRFNCF
HSQLKTFLE
Download sequence
Identical sequences A0A0D6LUV0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]