SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D6N0F8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6N0F8
Domain Number 1 Region: 798-1180
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.11e-112
Family PFOR PP module 0.0000000396
Further Details:      
 
Domain Number 2 Region: 422-671
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.2e-73
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000795
Further Details:      
 
Domain Number 3 Region: 4-258
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.47e-67
Family PFOR Pyr module 0.0000000792
Further Details:      
 
Domain Number 4 Region: 259-420
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.57e-40
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000192
Further Details:      
 
Domain Number 5 Region: 675-842
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 4.92e-21
Family Ferredoxin domains from multidomain proteins 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D6N0F8
Sequence length 1191
Comment (tr|A0A0D6N0F8|A0A0D6N0F8_9PROT) Pyruvate-flavodoxin oxidoreductase {ECO:0000256|PIRNR:PIRNR000159} KW=Complete proteome; Reference proteome OX=1231339 OS=Acetobacter cibinongensis 4H-1. GN=Abci_001_017 OC=Acetobacteraceae; Acetobacter.
Sequence
MTEQTVTLDGNTAVAHIAYRVNEVCAIYPITPSSSMAELADAWSDQGVKNIWGDIPVVQE
MQAEGGAAGCVHGSLQTGALTTTFTASQGLMLMLPNMFKIAGELTSTVFYVAARALAAGA
SSIFGDHQDIMAARTTGFAILGAGSVQEGHDLALVAQAATLAARVPFIHYTDGFRTSHEY
NGLFMVPDETIRAMIDDRLVQAHRQRALSPENPFIRGTWQNPDTYFQSREAVNPFYARVP
DAVQDAMDRFAALTGRHYGLFQYDGAPDAERVIISMDSGSHVVRDTAKWLCAQGQKVGAL
QVRLFRPFSAKHFLAALPKSVKQIAVLDRTKEPGAPMEPLHADCVSVLAEAVADGQFEHM
PRVIGGRYGLSSRDFNPGMARAVFDELAKPAPKNHFTIGIIDDVGHTNLTYDEGFDIEPE
GTVRCLFYGLGADGTVGANKNSVKILSEKPGWYAQAYFDYDSHKSGGETASHVRFGKQPI
NAPYLIRHADFVACHKFDFLFRRDVLAAANDGAPFLLNSPYGPEDVWDHLPRKVQDQIVQ
KKLKFFVINASEVALNLGLGPRVNTILQTCFFHLSNVLPQDEATAEIKKAIQHSYGAKGD
AVVQLNFKAVDAALAALHEVKVPQQAEGTLAMPPLVPAEAPKFVQQITREIMAGRGEAIP
VSHMPVDGTFLGGTTQYEKRNIAVEVPVWDADACLQCGQCSIVCPHSVIRAKMYEQKDLE
GAPEAFKSAPINARGYPDSRFTLQFYVEDCTGCGVCVENCPAIVPETEKRAINMGEKLPI
LEQERKNIAFFEKLPDMDRTTINEANVRGIQFLEPLFEFSGACAGCGEAPYLKLVSQLFG
DRLQIANATGCSAIFAGNTPAHAWKSNAEGRGVAWSNSLFEDNAEFGLGFRIAADKQTAL
ARMLLEKQAAAIGQDLTKALLGATMHTEYDFVQQRNRVAALKKKLESMESPDAIMLHSVA
DFLIRRSIWIIGGDGWAYDIDSGGLDHVLAQGRNVNVLVLDTEVYSNTGGQSSKATPLGA
SAKFAAAGKRAPRKDLALQAISYGNVYVAQIALGANPEQAVIAMREAEAYEGPSIILAYS
QCIAHGIDMRTGMKQQARAVASGYWPLFRFDPTMRKEGLNPFRLDSTRPRIPLEDYAYRE
LRYKTLVRSHPDAAAHMLHQAQAALNEKYRIYEDMAARDGSRFLPHWEDVG
Download sequence
Identical sequences A0A0D6N0F8
WP_048837112.1.45556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]