SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D6PL03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6PL03
Domain Number 1 Region: 156-345
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.44e-60
Family Methylesterase CheB, C-terminal domain 0.00000734
Further Details:      
 
Domain Number 2 Region: 11-116
Classification Level Classification E-value
Superfamily CheY-like 9.25e-24
Family CheY-related 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D6PL03
Sequence length 351
Comment (tr|A0A0D6PL03|A0A0D6PL03_9PROT) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=1231354 OS=Gluconobacter frateurii M-2. GN=Gbfr_001_038 OC=Acetobacteraceae; Gluconobacter.
Sequence
MFGGHKIYSETISVLVVDDSLTSRALITLALKRNPKIKVVGTAGTPLEAKDLILKLKPDV
LTLDVEMPGMNGLQFLEKIMRLRPMPVVMVSSLLAARSEMVEMACRLGAVECFSKSSGEQ
GEAVFVGLADVVVRAASQRVNAHLGVSTGFSGSSDFIVAIGASTGGVEALGEVLGSFPED
CPPTVIVQHMPQQFSKNFARRLNSISRPEVCLATDGCKLARGKVFIAPGGEMHTEVSRTG
RMSPYSCHLVSGPPLNGHRPSVDALFFSVAQAAGRHAVGVILTGMETDGARGLLAMRQSG
ARTIGQDRNTSIIYGMPKAAFECGAVEVQLPLSEIGPSVLRLAENRTQESH
Download sequence
Identical sequences A0A0D6PL03 K7ST77 M9LWD0
gi|414341502|ref|YP_006983023.1| WP_007283816.1.11921 WP_007283816.1.48853 WP_007283816.1.50704 WP_007283816.1.5426 WP_007283816.1.54382 WP_007283816.1.63811 WP_007283816.1.71064 WP_007283816.1.85131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]