SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D6RA16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6RA16
Domain Number 1 Region: 18-301
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.62e-82
Family Capz alpha-1 subunit 0.00000568
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D6RA16
Sequence length 315
Comment (tr|A0A0D6RA16|A0A0D6RA16_ARACU) Uncharacterized protein {ECO:0000313|EMBL:JAG99283.1} OX=56994 OS=Araucaria cunninghamii (Hoop pine) (Moreton Bay pine). GN= OC=Spermatophyta; Pinidae; Araucariales; Araucariaceae; Araucaria.
Sequence
MDMDMEMETEEEEVSALTERQKIEMAKWFLVNSPPGEIQYVAKDLRSVLMDENIYAKATA
EAFPLYNKSHMICLEMPNRSGQVIVTEFSELDGTQYLDPRTAQVATVNHVEQVCTEVRPA
TDVELASVYVEEFRYALDSELSKYVDEAYPKGECSVYCTAGKDAEGEGSNFELTAVISVA
KYSPQNFCNGRWRSVWKIEFKDDLQAVELKGKLGVVAHYFEEGNVQLDTCYECKDSTLMQ
TPEECASSITSIIRHHESEYLSSLEESYSKLSDTTFKDLRRKLPVTRTLFPWHNTLQLSL
TRDLAKELSFGKNQG
Download sequence
Identical sequences A0A0D6RA16

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]