SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D6TEV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6TEV2
Domain Number 1 Region: 13-199
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.57e-55
Family Methylesterase CheB, C-terminal domain 0.00016
Further Details:      
 
Domain Number 2 Region: 276-467
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.34e-50
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.0002
Further Details:      
 
Domain Number 3 Region: 211-278
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0000000000000602
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0069
Further Details:      
 
Domain Number 4 Region: 695-816
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000814
Family Flavin-binding PAS domain 0.031
Further Details:      
 
Domain Number 5 Region: 815-940
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000068
Family Flavin-binding PAS domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D6TEV2
Sequence length 1133
Comment (tr|A0A0D6TEV2|A0A0D6TEV2_9RHOB) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=1192054 OS=Paracoccus sp. 228. GN=SY26_00065 OC=Rhodobacteraceae; Paracoccus.
Sequence
MNDASPARATTRPPFAVVGIGASAGGLEALHDLLRDVRREDPAAYVVIQHLDPTHDSVLA
ELLDRRTALSVQQATDGTVLQPGHVYTIPPGARMLISDGRLHLTDFDQPRGLRRPIDDFF
ESLAHDRGPAAACVILSGTGADGTLGLRAVKEHGGICVIQEPRTARYDGMPLSAQSTGLV
DYVLPPERIVPAILQFFDSSETQQADDAMLADARLICRHLLDRCGHDFSGYKMTTLVRRI
RRRLQVLNIAGTRDYLRHLQRHPDECEALLNEFLINVTRFFRDPEMFQALREQAIRPMVA
AADGEELRVWVAGCSSGEEAYSVAMLIDTEMRAAGLRPRFTVFASDIDKKMIEIARAGTY
PISALADIPEEMRAAYTTHRDALMQITPQLRDRVRFSLHSVLRDPPFARVDLISCRNLLI
YLDEDLQSQVLPLFHYALRPGGYLFLGPSEGVRRESMHFTELDRPARLFQRDATPARLPL
DMPFLRSEGDRPSPATRSRKAEEGAARDGALAAQRRVLDRFAPASLQVSPAGEVLWTAGR
LGRFLAVDPTARKPILAPQIVHPGLKEAVTAALDQVAGTGRAAILRNLLARSDLGAQPVT
LFAEPLPDRSVLLVFHDAGAQALPDTLDETDELSVTESRSDLLEEQLRLTRIELHGAVQE
LETANEELKSSNEEMMSMNEELQSTNEELSTVNDELKSKIDDLTAANSDLQNFFSATKIP
LLVVDRDVRVRNFTAAALQIFPLRRSDHGRPLADVSNVFASDVLLSMAAEVARQGEAQGT
ELVEAGGTRVWRVDAKPYRGPEGHLDGAMLVFEDVTALRDLRVEVERQEERLNAVRSMAR
IAVWHYDAASRMLTIDDSSDLLGLGQTAQLPLSAFAALIAPADRDGLLADLQACAAGTAF
RRVVSPSSDARSAVRLETAAARFGTDDGDCRVLGVMLDVTAAQSAATLREAVISEMDHRV
KNLFTQISAMLRMAARETDDARTVVEEVSARINALASSHGLTTARGTKSQLPLADLIATT
LAPYDGARIDSGGDDLTIPARLVVPMSLILHELATNAFKYGVLGPVDGALQITWRRDGDG
AVLDWTERYDAPQAQDEPDAGFGSILLEGATSQIDGTLQVTLDADSRRTRLTF
Download sequence
Identical sequences A0A0D6TEV2
WP_045998783.1.91967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]