SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D6YEH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0D6YEH1
Domain Number - Region: 33-51
Classification Level Classification E-value
Superfamily MIR domain 0.068
Family MIR domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D6YEH1
Sequence length 225
Comment (tr|A0A0D6YEH1|A0A0D6YEH1_MASLA) Transporter {ECO:0000313|EMBL:KIY11737.1} KW=Complete proteome; Reference proteome OX=1594576 OS=Mastigocladus laminosus UU774. GN=SP67_20815 OC=Bacteria; Cyanobacteria; Nostocales; Hapalosiphonaceae; Mastigocladus.
Sequence
MNEFISTLLVGISAFIATNIDDIVILLILFSQTDSSFRCRHIVTGQYLGFTVLVIASLPG
LFSGSVIAPNWIGLLGLIPIAMGISSLINREENVSEEIVITPVDYEDSNTITFLNPYIYS
VAAITIANGSDNITVYVPLFASGNLSNFLIIIVAFFILIAIWCYLAYKFTSYSKITNLLS
KYANYIFPVVFIGIGSFIILKNEALSLFKLAISCICLVIILNNNK
Download sequence
Identical sequences A0A0D6YEH1
WP_017308544.1.78847 WP_017308544.1.920 WP_017308544.1.98017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]