SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D6YFF6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0D6YFF6
Domain Number - Region: 18-60
Classification Level Classification E-value
Superfamily HMG-box 0.00438
Family HMG-box 0.017
Further Details:      
 
Domain Number - Region: 61-91
Classification Level Classification E-value
Superfamily BEACH domain 0.034
Family BEACH domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D6YFF6
Sequence length 107
Comment (tr|A0A0D6YFF6|A0A0D6YFF6_MASLA) Uncharacterized protein {ECO:0000313|EMBL:KIY12129.1} KW=Complete proteome; Reference proteome OX=1594576 OS=Mastigocladus laminosus UU774. GN=SP67_17700 OC=Bacteria; Cyanobacteria; Nostocales; Hapalosiphonaceae; Mastigocladus.
Sequence
MGFFDSEIVQQEAKQLFEDYQALIKLGNNYGKFDREGKKLFIEQMEAMMERYRVFMKRFE
LSEDFMAQMTIQQLKTQLSQFGVTPQQMFDQMNITLERMKAELEKQK
Download sequence
Identical sequences A0A0D6YFF6 A0A1Z4THQ5
WP_017311427.1.78847 WP_017311427.1.920 WP_017311427.1.98017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]