SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D6YKH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6YKH8
Domain Number 1 Region: 35-146
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0000000000654
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.042
Further Details:      
 
Domain Number 2 Region: 169-291
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.0000000000863
Family HEPN domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D6YKH8
Sequence length 298
Comment (tr|A0A0D6YKH8|A0A0D6YKH8_MASLA) Nucleotidyltransferase {ECO:0000313|EMBL:KIY13899.1} KW=Complete proteome; Reference proteome OX=1594576 OS=Mastigocladus laminosus UU774. GN=SP67_07605 OC=Bacteria; Cyanobacteria; Nostocales; Hapalosiphonaceae; Mastigocladus.
Sequence
MRTGLDHLPSSKQRELAHVVRVLFEEFERQIGLATQPWKKRGRILKVILYGSYARGDWVD
DPVGGYKSDYDILVVVNDAKLTDPVEYWGQADDRLMRDATINEALSAPVNFIVHDLADVN
DQLVHGRPFFVDIAEQGIALYEAEGFELATPRLLPPGEARAEAQTHFERWLPSADAFLAS
AEFLRARGDRNEAAFNLHQAAERLYHCVLLVLTLYSPKSHKLNFLRSHAEEAAPELVGAW
PRAEKAERRKFELLRQAYVNARYSPHYEISDDELRWLGERVAELQRMVRQVCDDRLQG
Download sequence
Identical sequences A0A0D6YKH8
WP_044448536.1.920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]