SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D6Z7D6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D6Z7D6
Domain Number 1 Region: 12-196
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 6.41e-39
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0029
Further Details:      
 
Domain Number 2 Region: 247-322
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 7.85e-16
Family Ferredoxin domains from multidomain proteins 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D6Z7D6
Sequence length 337
Comment (tr|A0A0D6Z7D6|A0A0D6Z7D6_9BACI) Ferredoxin {ECO:0000313|EMBL:KIY21694.1} KW=Complete proteome; Reference proteome OX=285983 OS=Bacillus subterraneus. GN=UB32_12330 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MSILSKKNELGFYEIRLESIGGLGANLAGKMLAEAGVLGLGLNGSNFSSYGSEKKGSPVK
SFVRFCDPETEIRVHSPIEEPHVVGVFHEALYKTIDVVSGLRPDGILLVNSTRDFDEIKQ
DLHLQYGTLAIVDALSIAVEEKTKVNTAMLGALYRIIDFLDPEAMKHVIRKTFEKKYPHF
VESNIRTFERGYNEVHFKTYESEQGAQGKDFKRPIPLLGYETQELGGVITAQANSILKDL
SGSRQGFLPQFNQAACINCAACDTACPDYCFVWEAGEDKRGRKQMFLKGIDYQYCKGCLK
CVEACPTTALSELREMIGYAEENQVKQNYPYVTGGVS
Download sequence
Identical sequences A0A0D6Z7D6
WP_044394206.1.5738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]