SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D7FAS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D7FAS4
Domain Number 1 Region: 12-105
Classification Level Classification E-value
Superfamily DnaK suppressor protein DksA, alpha-hairpin domain 1.44e-33
Family DnaK suppressor protein DksA, alpha-hairpin domain 0.000023
Further Details:      
 
Domain Number 2 Region: 107-144
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000641
Family Prokaryotic DksA/TraR C4-type zinc finger 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D7FAS4
Sequence length 147
Comment (tr|A0A0D7FAS4|A0A0D7FAS4_9PSED) RNA polymerase-binding transcription factor DksA {ECO:0000256|HAMAP-Rule:MF_00926} KW=Complete proteome OX=47885 OS=Pseudomonas oryzihabitans. GN=UM91_14020 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MPSEANQQNNHLARGYEPYQPAKGEEYMSERMRAHFTGILNKWKQELREEVDRTVHHMKE
EAANFADPADRATQEEEFSLELRARDRERKLIKKIDETLQLIEDNEYGWCDSCGVEIGIR
RLEARPTASLCIDCKTLAEIREKQTGT
Download sequence
Identical sequences A0A0D7FAS4 A0A1G5NP58 A0A257BR59
WP_007159704.1.12146 WP_007159704.1.21585 WP_007159704.1.33571 WP_007159704.1.35344 WP_007159704.1.36671 WP_007159704.1.48653 WP_007159704.1.56613 WP_007159704.1.79521 WP_007159704.1.83841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]