SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D7FE45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D7FE45
Domain Number 1 Region: 22-205
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.62e-53
Family Methylesterase CheB, C-terminal domain 0.00041
Further Details:      
 
Domain Number 2 Region: 300-497
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.63e-50
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00025
Further Details:      
 
Domain Number 3 Region: 1063-1235
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.14e-44
Family Histidine kinase 0.00064
Further Details:      
 
Domain Number 4 Region: 1251-1369
Classification Level Classification E-value
Superfamily CheY-like 1.35e-33
Family CheY-related 0.012
Further Details:      
 
Domain Number 5 Region: 856-984
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.97e-21
Family Heme-binding PAS domain 0.013
Further Details:      
 
Domain Number 6 Region: 996-1075
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000000051
Family Homodimeric domain of signal transducing histidine kinase 0.0031
Further Details:      
 
Domain Number 7 Region: 236-302
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0000000000222
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0095
Further Details:      
 
Domain Number 8 Region: 737-857
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000209
Family Flavin-binding PAS domain 0.043
Further Details:      
 
Domain Number 9 Region: 540-645
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000535
Family Flavin-binding PAS domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D7FE45
Sequence length 1372
Comment (tr|A0A0D7FE45|A0A0D7FE45_9PSED) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome OX=47885 OS=Pseudomonas oryzihabitans. GN=UM91_09040 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSKQADVAKPNSPKHLTPSDLPFPVVGIGASAGGIQALLRFFEALPADCGMAFVVVMHLS
REYQSNLDQILQRATRLPVQQVTQPVPIQAEHVYVIPPGHDLTMNDGYLRLSPAERPQGD
HVAVDLFFRTLADVHRTRAIAIVLSGNGADGAVGLGRIKEQGGVTLAQAPEDAEFDSMPS
SAIAAGAVDFILPVVEMPQKLLELATTISSLSQSELRQLDYESRVPGPSSKAMQLALRDI
LTLLRTRTGHNFKQYKTATVLRRVERRMQVNAIADMPAYAGFLHEHPEETPALLKDMLIG
VTNFFRDREAFEALERDVIPELFEQLPVNEDDQELRVWSAACSSGEEAYSLAMLLTEQAE
LRQSGARLQVFATDLDEHALAVARHGVYPGSIVTDVAPARLRQHLLKEQNQYRVKKELRE
KVLFAQHNLLSDPPFSRLDLISCRNLLIYLDREVQAEILHTFHFALKPGGYLFLGSSESA
DVQSSLFATVDKKNRIYRAKHTTSVVRPTPLLNLNPGIHSVRLPPNQVGRRKKVSFAEVH
QRVLEQYAPPSIIVDRESNIVHMSERAGRFLRYVGGEPSYSLPALVLEELRLELRTALFQ
ALQSNKSVEARRVHIQRDDRSYYINMVVRPFRDSDTSTDYMLVLFDEVEDVMSTDAGGDH
TEAKDSVLTQLEAELQRTKEQLQLTIEQSETSTEELKASNEELQAINEELRSATEELETS
KEELQSINEELITVNYELKSKIEETGKINDDLQNLITSTDIATVFVDRGMRIKRFTPRAA
SIFNIIVSDTGRSLLDITHRLDYPELAADASQVFESLGLIEREVRSHDEHWYLARLLPYR
TAEDRIEGAVLTFIDITERRLAQDRARAGEENMRLVAQNIQDYAIVTLDAAGIINSWNGG
ATRLFGYSEREALGQPMGLIFTPEDVAAQVPDAEMRQAREAGVAHDERWLRRKDGSRLYC
TGVLSRMSNASGGEGYAKIARDATADHVRASETANHLAQSQALGKLKDEFFAVMSHELKH
PLNLIQLNSELLTRSPVLREVPLARRATEAIQRAVRSQAQIIDDLLDLSRIRTGKLKLER
RSLDLAQQLREIADVIRPLAGEVEVSCTRLPETPLHVQADATRIGQIVWNLLNNAIKFTP
AGGQVEISLGVDGDEARLDVTDTGQGIAADFLPRVFDMFGQAEMKYTARAQHGLGIGLAL
VKQLVEAHGGRIEAHSEGLGLGARFSVWLPLCQDDERQLDEAQAEGQSVVGLRVLLVDDS
PDIVETLQLLLEEEGILVTAATDSQSGLALAQAQDFDVILSDIGMPEMDGHEFLRQIRAG
DRNVGTPAVALSGYGTRLDIDKARAAGFARHLNKPVSFEALIAILQELQASG
Download sequence
Identical sequences A0A0D7FE45
WP_044341651.1.33571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]