SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D7K742 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D7K742
Domain Number 1 Region: 5-276
Classification Level Classification E-value
Superfamily Terpenoid synthases 5.14e-87
Family Squalene synthase 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D7K742
Sequence length 279
Comment (tr|A0A0D7K742|A0A0D7K742_9BURK) Phytoene synthase {ECO:0000313|EMBL:KJA08978.1} KW=Complete proteome; Reference proteome OX=80878 OS=Acidovorax temperans. GN=RP29_19065 OC=Comamonadaceae; Acidovorax.
Sequence
MTPEQYVQQKAVASGSSFYYAFLFLPAPRRAAITAFYAFCREVDDVVDEVSDPGVARTKL
AWWQAEVAKAFGGQPTHPVMQALMPHTRDYGIEQRHLQAVIDGCQMDLEQTRYLDFAGLK
GYCHLVAGIVGEVAARIFGQTDERTTQYAHTLGLAFQLTNIIRDVGEDAMLGRIYLPVSE
LQQFDVKAHEILKRTYSDRFTALMRFQAERAHRLYDEALALLPDADRRAQKPGLMMASIY
RTLLREIEHDNFQVLHQRIRLTPLRKFWLAWKVQALGRM
Download sequence
Identical sequences A0A0D7K742
WP_044402515.1.61656 WP_044402515.1.89711 WP_044402515.1.93628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]