SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D7KPW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D7KPW5
Domain Number 1 Region: 13-114
Classification Level Classification E-value
Superfamily HisI-like 3.4e-45
Family HisI-like 0.0000923
Further Details:      
 
Domain Number 2 Region: 131-219
Classification Level Classification E-value
Superfamily all-alpha NTP pyrophosphatases 1.08e-27
Family HisE-like (PRA-PH) 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D7KPW5
Sequence length 235
Comment (tr|A0A0D7KPW5|A0A0D7KPW5_9BACL) Phosphoribosyl-ATP pyrophosphatase {ECO:0000256|HAMAP-Rule:MF_01019} KW=Complete proteome OX=1458845 OS=Paenibacillus sp. E194. GN=AZ66_14330 OC=Paenibacillus.
Sequence
MMQQAIVDGERLAASIRWNEYGLVPTVVQDSVTKEVLMVAYMNQESLLLSCETGETVFWS
RSRQELWHKGATSGNTQRIVSIAVDCDQDTLLVQVSPSGPACHTGSRTCFDSGHMGCVRE
EESHAPVVNSVLAELENLIAQRQIERPEGSYTTYLFEKGLDKILKKIGEESTEVVIAAKS
DNKEELVGEIGDLLFHMLVLLRERNIALGDVLSVLEARHRGSRRDTYNQNGKVKS
Download sequence
Identical sequences A0A0D7KPW5
WP_044355362.1.37970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]