SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D7L5I8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D7L5I8
Domain Number 1 Region: 11-63
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.000000000000392
Family H-NS histone-like proteins 0.001
Further Details:      
 
Domain Number 2 Region: 97-140
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.0000000029
Family H-NS histone-like proteins 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D7L5I8
Sequence length 151
Comment (tr|A0A0D7L5I8|A0A0D7L5I8_CITFR) DNA-binding protein {ECO:0000313|EMBL:KJC01641.1} KW=Complete proteome OX=546 OS=Citrobacter freundii. GN=TO64_26635 OC=Enterobacteriaceae; Citrobacter; Citrobacter freundii complex.
Sequence
MSDNETFDAARRLLTNIRSVRVFARETSFEQLLEMQEKLNAVIEERREDAEREAAERQER
EKKRQELLQLIAGEGFSPEELLGLTDDAPNARKSKLPKAPPKYQFEENGEVKFWSGRGRS
PKPIDEALKAGRSLDDFLIKKEPSGSADDKQ
Download sequence
Identical sequences A0A0D7L5I8 A0A154CG45 A0A1Y6HR25 A0A221ZPJ7 A0A2I8TTF7 A0A2J3QG41
WP_044715196.1.10794 WP_044715196.1.11957 WP_044715196.1.16753 WP_044715196.1.19991 WP_044715196.1.22141 WP_044715196.1.22517 WP_044715196.1.26356 WP_044715196.1.26874 WP_044715196.1.35454 WP_044715196.1.38189 WP_044715196.1.40998 WP_044715196.1.42159 WP_044715196.1.44805 WP_044715196.1.53061 WP_044715196.1.55048 WP_044715196.1.58399 WP_044715196.1.63572 WP_044715196.1.67087 WP_044715196.1.72582 WP_044715196.1.77655 WP_044715196.1.78362 WP_044715196.1.80869 WP_044715196.1.85063 WP_044715196.1.88202 WP_044715196.1.90073 WP_044715196.1.92418 WP_044715196.1.93030 WP_044715196.1.93660 WP_044715196.1.94939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]