SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D7QES1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D7QES1
Domain Number 1 Region: 210-483
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.36e-58
Family PFOR Pyr module 0.013
Further Details:      
 
Domain Number 2 Region: 15-194
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.05e-20
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.02
Further Details:      
 
Domain Number 3 Region: 501-601
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000973
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D7QES1
Sequence length 615
Comment (tr|A0A0D7QES1|A0A0D7QES1_9BRAD) Ferredoxin oxidoreductase {ECO:0000313|EMBL:KJC61008.1} KW=Complete proteome OX=1619233 OS=Bradyrhizobium sp. LTSPM299. GN=UP10_08790 OC=Bradyrhizobiaceae; Bradyrhizobium.
Sequence
MSVQSPIGSVNDFVVRFANVNGSGSASANELFARSILRHGVPVSPRNIFPSNIQGLPTWY
EVRVTEAGHLGARGGVDLMVAMNPQTWDKDVASIEPGGYLFYDSTKPMPTSKFREDITVI
GVPLTAITNSTYSDPRQRQLFKNIIYLGALCALLDLDPKLVEQLIGEQYKGKEKLLSSNI
HALHLGRDWALQNLKCPIGLRVKKSDKVGDRIFIEGNSAAALGAVYGGATVCAWYPITPS
SSVAEAFTAHCKKYRHDPATGKAKYAIVQGEDELASIGIVIGASWNGARAFTATSGPGIS
LMTEFIGLSYFAEIPAVIMNIQRAGPSTGMPTRTQQCDVISCAYASHGDTKHVLLFPEDP
AEAFEFAAAAFDLAERLQTTIFVMLDLDIGMNHRLSRPLKWDDARQYDRGKVMTAEMLDE
GRDFGRYLDVDGDGIPYRTYPGTHPTKGSYFTRGTSRDRYARYSEEGAVYADNMQRLVRK
FETAQDMVPRPLQANAAKPTKYGVIYFGSTSPAMDEAIGLLESRGHHLDRLRIRAFPFHS
SVASFIADHDFVYVVEQNRDAQLRQLIVNENGIDPVRLVPILHYDGTPITARFIANSIGD
HQDHLKVTPLRKAVS
Download sequence
Identical sequences A0A0D7QES1
WP_044586952.1.16582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]