SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D7XID6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0D7XID6
Domain Number - Region: 8-88
Classification Level Classification E-value
Superfamily RNA-binding protein She2p 0.00719
Family RNA-binding protein She2p 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D7XID6
Sequence length 232
Comment (tr|A0A0D7XID6|A0A0D7XID6_BACAM) Uncharacterized protein {ECO:0000313|EMBL:KJD55292.1} KW=Complete proteome OX=1390 OS=Bacillus amyloliquefaciens (Bacillus velezensis). GN=UZ38_23000 OC=Bacillus amyloliquefaciens group.
Sequence
MVNVLTNILKNDRLDVYPLFKKFCSLKEKGLRKESFKALSSFIDEAKMWDDNAQQNFACW
LFALFETSDDIHHVLVHPLEKELLKPLLERWMKSNPEDPRPYRWYGVFLNTENRVDYLHN
ALRLGGSNEQLSLLTLIDINLNALWYSFHHISEDLYLGDIKEDTALLAKSRELNNKVECQ
QTRKNNNEALNYYQDLLNDWVMFTKEQSKGFVEWCEHKGRNYYWVKAYYYEK
Download sequence
Identical sequences A0A0D7XID6 R9TUV0
WP_020451545.1.17986 WP_020451545.1.74801 WP_020451545.1.80397 WP_020451545.1.97335 gi|511062830|ref|YP_008078148.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]