SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D8BSA8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D8BSA8
Domain Number 1 Region: 19-119
Classification Level Classification E-value
Superfamily FlaG-like 2.35e-28
Family FlaG-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D8BSA8
Sequence length 119
Comment (tr|A0A0D8BSA8|A0A0D8BSA8_GEOKU) FlaG family protein {ECO:0000313|EMBL:KJE27098.1} KW=Complete proteome OX=1462 OS=Geobacillus kaustophilus. GN=LG52_3206 OC=Geobacillus thermoleovorans group.
Sequence
MTIERVSSSFLSYEPTRTEQVNPKVEFSAARPQEAEASSPLERLPSEETLEKVVNGLNEL
VQPSHTSVRFELHKELHEYYVQVIDEKTQEVIREIPPKKLLDMYAAMMEFVGLLVDKKI
Download sequence
Identical sequences A0A0D8BSA8
WP_044732654.1.38260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]