SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D8FXB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D8FXB8
Domain Number 1 Region: 153-336
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.88e-47
Family Methylesterase CheB, C-terminal domain 0.0000905
Further Details:      
 
Domain Number 2 Region: 1-131
Classification Level Classification E-value
Superfamily CheY-like 6.26e-28
Family CheY-related 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D8FXB8
Sequence length 345
Comment (tr|A0A0D8FXB8|A0A0D8FXB8_9ACTN) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=1121877 OS=Ferrimicrobium acidiphilum DSM 19497. GN=FEAC_12410 OC=Acidimicrobiaceae; Ferrimicrobium.
Sequence
MARILIADDSNVIRTRVASWIAHEHDLELVGQAENGARCVDLFQRLKPDVIILDVEMPEL
DGIETLRQIRAIDATVPVIMFSALTELGSRTTVASMLAGATDHVAKPASFRVEDETRRLL
IARVRSLVRLRVFVSLTSSSTSVIEHHETQIPEAPEIIVVAASTGGPPALREFLTAVGRI
EVPIVVVQHIPAHFLGLLVEQLATMLAADVAIGIDGEALTAGSVRFAPSGTHIEVRSREG
RMLLGYSDLPPVNSCKPSADILFASAAMTARRPIAVILSGMGSDGLVGAGTIVANGGGVY
AQDRRSSAVWGMPGSVVDQGLARLVGPPDRIGARIRLLSQRAVRV
Download sequence
Identical sequences A0A0D8FXB8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]