SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D8IC00 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D8IC00
Domain Number 1 Region: 74-216
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 1.57e-41
Family Cobalamin (vitamin B12)-binding domain 0.00028
Further Details:      
 
Domain Number 2 Region: 4-88
Classification Level Classification E-value
Superfamily Methionine synthase domain 1.96e-20
Family Methionine synthase domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D8IC00
Sequence length 218
Comment (tr|A0A0D8IC00|A0A0D8IC00_9CLOT) Dimethylamine corrinoid protein MtbC {ECO:0000313|EMBL:AKL95699.1} KW=Complete proteome; Reference proteome OX=84022 OS=Clostridium aceticum. GN=CACET_c22530 OC=Clostridium.
Sequence
MPASKEELLKRLSEGVVNMEEEDVIEACNEYIAAGYTIFDGIMEGLVDGMNRASQLFEEE
EYFVTDVLLCSDAMYEGLAVLRPHLPAEEAEKEKIKGVIGVVEGDTHDIGKNLVKIMLET
AGFEMLDLGRDVPLQHFVDKAKEVNASFVCMSTLMTTTMGGMGKVIELLKEADLKEQVKV
LIGGGPISKKYADTIGADGYASNAVEAVKTVKNLLDIA
Download sequence
Identical sequences A0A0D8IC00
WP_044825005.1.68573 WP_044825005.1.77615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]