SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D8JA30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D8JA30
Domain Number 1 Region: 1-118
Classification Level Classification E-value
Superfamily DsrEFH-like 4.84e-33
Family DsrEF-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D8JA30
Sequence length 118
Comment (tr|A0A0D8JA30|A0A0D8JA30_9BACT) Uncharacterized protein {ECO:0000313|EMBL:KJF43604.1} KW=Complete proteome OX=1544798 OS=Draconibacterium sediminis. GN=LH29_10815 OC=Prolixibacteraceae; Draconibacterium.
Sequence
MQKILILINDGPYGTEKAYNGLRLANQLNKAHEDVEVRIFLMADAATCAIPGQVTPNGYY
NIERMLKYSINKGAKVKICGSCADARGIKNKELIEGAEISTMAELTQWVVDSDKMVTF
Download sequence
Identical sequences A0A0D8JA30
WP_045030178.1.67185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]