SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D8P8U3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D8P8U3
Domain Number 1 Region: 17-54
Classification Level Classification E-value
Superfamily H-NS histone-like proteins 0.00000000549
Family H-NS histone-like proteins 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D8P8U3
Sequence length 54
Comment (tr|A0A0D8P8U3|A0A0D8P8U3_9GAMM) Transcriptional regulator {ECO:0000313|EMBL:KJG15060.1} KW=Complete proteome; Reference proteome OX=56192 OS=Photobacterium iliopiscarium. GN=UB37_20380 OC=Vibrionaceae; Photobacterium.
Sequence
FDLVTKTPTTKKAPRTPRPAKYAYTDEDGQSKTWTGQGRTPKFLIDKNLDDFLI
Download sequence
Identical sequences A0A0D8P8U3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]