SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D8XX81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D8XX81
Domain Number 1 Region: 537-678
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 5.62e-36
Family IP3 receptor type 1 binding core, domain 2 0.0000317
Further Details:      
 
Domain Number 2 Region: 285-380
Classification Level Classification E-value
Superfamily MIR domain 6.02e-27
Family MIR domain 0.00011
Further Details:      
 
Domain Number 3 Region: 1230-1338
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 6.67e-19
Family IP3 receptor type 1 binding core, domain 2 0.016
Further Details:      
 
Domain Number 4 Region: 466-529
Classification Level Classification E-value
Superfamily MIR domain 0.00000000759
Family MIR domain 0.0026
Further Details:      
 
Domain Number 5 Region: 115-174
Classification Level Classification E-value
Superfamily MIR domain 0.0000000628
Family MIR domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D8XX81
Sequence length 1970
Comment (tr|A0A0D8XX81|A0A0D8XX81_DICVI) RIH domain protein {ECO:0000313|EMBL:KJH49238.1} KW=Complete proteome; Reference proteome OX=29172 OS=Dictyocaulus viviparus (Bovine lungworm). GN=DICVIV_04618 OC=Dictyocaulus.
Sequence
MNADIGNISLLHFGDIISLYTEESADLRGFLSTLGLVDDRCIVELRDGRPESPPKKFRDC
LFKVCPVNRYAAQKQLWTEQKRFISGESTFDSDMMNKLCIAAEKEKEQNELEFRKTLGNV
IQYGTTVQLLHMKSDKYITVQKNTPAKCERNAMKVYLDRAGNEGSWFIIEPAYKHYVIGD
SVRKLVIHLLSADEHEPDAFNIQAVYDVKRLRQPVAAGNKISLIPYSVNNHSSSGHVKHQ
LHLSHYVLKDHQTAVEVNCLNECTEWQVFMFLLFNENQQDIVKSGDVVRLFHADQQTFLT
LDVVPNTSPPKDVVFLRMTNRPSAADATSSRALWEVQVVQKDAYRGGAASWRECYRFKHL
ATDMYLTAVQTVASVKSSTNDRRAYFTQIKARAEHLPPSSDMLYDEETPDVCSFGIYFLM
PITSDFPEADKRLLFSLDPGTMPKQLPHSFIHRYTVSITRIPDFFFQNKDVPCKSYVRLQ
HEATGMWVHATNPNDKYNLYYSSKTEKGWVRVICANSRVDKETFALLPVHPNEVHSFIIP
LPVTIQLLTECIYFVTNTKNHMRDPLQINDFVPSRDRQKLLREQEVLDQVFLLLKAPFMP
RQGITEIGPLLSSPSDLSEGRNEIFKTMFQLCYSLLRYSQTNYRKNQEFLAEKFGQIQEQ
IGYDLLAEDTMTAVLHNNPKLLEKYVKTPHVERFIELVRNNRLGKFLDYLADLCVCRGEA
NKKIQELICNSVLSTKHRDILMDTKMVDGEVYIGWMDQKLRSLVELADGSKNIKTEDAEF
LDYYRHQLDLLAQMCQEQQYLAIDPPPERKLLNLSQQLPAHLVLRCVSDGRLPCDVRASF
ARLMLHLHVVRGSPLCAIRHARLWTDIPVEVKLQSYKITSLEGYSDGGRSRVGDQFATDV
LNTVENYLHSLRHNRPSGPLLKDDATSIAKNKLTHEMVTLAKALAQFGYYTFDNLLKLTE
NLLNIVDNSPQNLQTARTVSQGMSMIQRVTRSMTLGGKLGDGPMMKNSEKNAIDDNIQAK
ESRHLLLRTKLTVAEILQFVMDVRRDYRITMALSWFKENFPCNEDGVLKQTASINERMAH
ELYETIYQSSGHELHLDRGDGQLLLAILMQVQLLVSSDDVENYRQVDRDLFILKNLTEKS
ELWVRSERHHSIDAKDHERDDKITKSDFEEHSLITSKGFTSDDILKAVVATIDEHYPNLR
KESLRLLNQKTLECMKSLLDIFKTLFVRKEDGFLKQILVRLKKLCYKNDRPEIMNQQLLK
NMRVYEVVLEFLSIPYDKEDWNILNYLQKNDTEMPRLITLSHEFLRSFCRGNKENQIRLH
RYISIEKDAKEGTLRVETVGIVLFIFLFIVFHTVEEAATLVAIFRNNRELAANVSEDLIA
HIVNLIEHKVSEYLLVVRMLKVIAIKPTRNAIFLELLQSLVCIHDKEIEPTQEKVASEIC
AASDEVRALYVDNASFEQLEQMMQQAPQYLDNTHPLKYHIELSDEFYIQVTCDVHTWKKR
KHRVEMRIRDPDGSYSSSCHVTILPNRGKREVMSSTFRLLAMCTRGKNGSIELKCASEIP
MDHIVRVVTSPFCLIEVKTAYFQFLLHCYIDTDAEMKDAYKPEYVDLLLQNMLLDVQKLQ
HELTVSSSNCAILEQYVCVTATEMLLKFFEKTYSEQAKAHKKMFTALLQNLCVLHAGSLK
RSQSPKHWYRIDQCIKRLRRWAEENKIALPASIVLPPFTSAPSVKQRWQCAANSARFIGQ
RTLTMRNRTNSLVMPGYNNNHHVTEKVANVVTCYHIDVYLLRLIQHCKTLMQKKQDNLCT
RVLQTLYRMCNSTKQSLSEQGEQLRLKLLQRYFGSRGNLEQNANNDTLAGNNSSGNQERK
LEIKLEERSLYDIQCRLNDAGASDLVIDIITDEPSQEIFLKAIQLAKAILLDGNDKVQQS
FYDRLKKKDPHELFFKAISSRIQAAQNRLKSDMMSCNENRPKGVDEHSQP
Download sequence
Identical sequences A0A0D8XX81

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]