SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D8Y223 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D8Y223
Domain Number 1 Region: 96-145
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 0.000000000245
Family Steroid-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D8Y223
Sequence length 149
Comment (tr|A0A0D8Y223|A0A0D8Y223_DICVI) Cytochrome b5-like Heme/Steroid binding domain protein {ECO:0000313|EMBL:KJH48646.1} KW=Complete proteome; Reference proteome OX=29172 OS=Dictyocaulus viviparus (Bovine lungworm). GN=DICVIV_05205 OC=Dictyocaulus.
Sequence
MDFATVFEMTSFDWVLLVLLVVLFWRWLRRRGESDVKPPSPYIVPPLPKCDMTLKELRVY
DGVHDDHILFALNGTVNSFKSIMVRSMIGPPMNKIKIYDVSRGRNFYGPGGPYSALAGRD
ATRPLSTMDMEDIKEDWDDHEDLTNDQKV
Download sequence
Identical sequences A0A0D8Y223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]