SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D8YBI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D8YBI9
Domain Number 1 Region: 2-76
Classification Level Classification E-value
Superfamily MIR domain 6.02e-18
Family MIR domain 0.0028
Further Details:      
 
Domain Number 2 Region: 385-515
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000989
Family SPRY domain 0.045
Further Details:      
 
Domain Number 3 Region: 155-258
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000667
Family IP3 receptor type 1 binding core, domain 2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D8YBI9
Sequence length 864
Comment (tr|A0A0D8YBI9|A0A0D8YBI9_DICVI) RIH domain protein {ECO:0000313|EMBL:KJH53389.1} KW=Complete proteome; Reference proteome OX=29172 OS=Dictyocaulus viviparus (Bovine lungworm). GN=DICVIV_00327 OC=Dictyocaulus.
Sequence
MVIYEGGQAVTQARSLWRVELIRMKWHGALIGWEQLFRIKHITSGRYLGVMDNAVQLYHK
DKADFDLTAFVMCQNKVEEKKAVALKDGHMDDCYTFFMALEEESKSARVIRKCSSVLNRF
LNFFMSFCLDETNPSNLLLRGIDALQNEGNESADWERVDLNEVLKLMEDLIEYFSQPGDD
QDFEHKQNRYRALRSRQDLFQEEGVLNMILDTIDKFSQMESLPDFAGLIGEDTHTMWEEI
STYLYLLVAAMIKGNHYNCAQFAAAQRLDWLFGRLSNPQSAEGILDVLYCVLTESPEALN
MINECHISSVISLLEKVGRDPKVLDVLSSLCEGNGMAVRSSQNLITTYLLPGKDLLLQTA
MRDHVSSMMPNVLVGVVEASALFRRWYFEAEVEHIEKMTKEDPYLRIGWANSHGFRPFPG
SGDRWGCNGVGDDFYSYGFDGRCVYFAGKGRVVASRLFEKGDVIGCSLDLNVPEIRFTVN
GQDVGACYKDFNIDGYFFPVMSLSAKVSCRFIFGGDQGRLRFGPPPGFSATVEAVSGELQ
IFDCLSFGDIQKNVYCGPHTLFTSTEPFVPQPVDISGINLPHHIEDVHTKFAGNLHELWA
MRKIELGWSYGEIRSEALRKHPCLTSFERLPATEMQYNINLALDTLKTIEALGYHLIIDQ
PPTRLRPVRLAQNFQQSNGYRPQPLDTHEIILPAELQPLIEALAKNTHNVWAKEKIKRGW
TFGLSEFVDSTQKRSPHLVPYEEVDNRIKEANRESAAENLRALQLYGIFIEAPGHEHDEL
AEKEMRTRKDSCRTYRAEATYAVSSGKCYLGRKWHQGAEIYGKEWKDPSGSEMAFDNVIC
GDGLVPAMTLGSGQRGQGTFFLFC
Download sequence
Identical sequences A0A0D8YBI9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]