SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D9A6M2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9A6M2
Domain Number 1 Region: 14-197
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.44e-64
Family Methylesterase CheB, C-terminal domain 0.00000804
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D9A6M2
Sequence length 199
Comment (tr|A0A0D9A6M2|A0A0D9A6M2_9PSED) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome OX=1628833 OS=Pseudomonas sp. ES3-33. GN=UB23_20865 OC=Pseudomonadaceae; Pseudomonas.
Sequence
PAPAPSSPAPKRKGYKLVAIGTSTGGPVALQRVLTQLPANFPAPIVLVQHMPAAFTKAFA
ERLDKLCRIHVKEAEDGDILRPGLALLAPGGKQMMIDGRGAVKILPGDERLNYKPCVDIT
FGSAAKSYGDKVLAVVLTGMGADGREGARLLKQGGSTIWAQDEASCVIYGMPMAIVKAEL
ADAVYSLDEIGRHLVEACV
Download sequence
Identical sequences A0A0D9A6M2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]