SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D9AGK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9AGK8
Domain Number 1 Region: 11-194
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 8.11e-57
Family Methylesterase CheB, C-terminal domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D9AGK8
Sequence length 195
Comment (tr|A0A0D9AGK8|A0A0D9AGK8_PSEST) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome OX=316 OS=Pseudomonas stutzeri (Pseudomonas perfectomarina). GN=UF78_19765 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MDTSTNPLARRIDAVVIGASAGGLAALSMLVEGLTSDLRQPLLMVQHVPPSGPTQLAEIF
RRKTALRVKEADDKEVVRGGTLYFAAPGYHLLVEADLSLSLSQDDAVHFSRPSIDVLFES
AADAWGDRVAGILLTGANEDGAAGLEAIRRSGGVTIVQDPEEAEVPTMPLSALQRFAPDY
ILPLRDIHNLLRELE
Download sequence
Identical sequences A0A0D9AGK8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]