SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D9AZ89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9AZ89
Domain Number 1 Region: 10-193
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.02e-56
Family Methylesterase CheB, C-terminal domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D9AZ89
Sequence length 195
Comment (tr|A0A0D9AZ89|A0A0D9AZ89_PSEFL) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome OX=294 OS=Pseudomonas fluorescens. GN=UG46_12595 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MNPMTDRSSQLVEAVVVGASAGGVEALLKIFTPLRKGFRLPVLVVLHLPDERNSQLAQVL
RHRLAIPVEEARDKQDICPGTLYVATPGYHLSVEADRSLSLSLEEPVHHSRPSIDVLFES
AADVYGPRLLAVVLTGANSDGAKGLARVKALGGITVVQDPTEAQVATMPEAALGLHEPDH
ILTLQGIGQLLAGLE
Download sequence
Identical sequences A0A0D9AZ89
WP_045155895.1.90719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]