SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9N0J9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9N0J9
Domain Number 1 Region: 33-191
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 7.05e-32
Family N-acetylmuramoyl-L-alanine amidase-like 0.00088
Further Details:      
 
Domain Number 2 Region: 207-250
Classification Level Classification E-value
Superfamily LysM domain 0.0000000811
Family LysM domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D9N0J9
Sequence length 261
Comment (tr|A0A0D9N0J9|A0A0D9N0J9_ASPFA) LysM domain protein {ECO:0000313|EMBL:KJJ33614.1} KW=Complete proteome; Reference proteome OX=1392242 OS=Aspergillus flavus (strain ATCC MYA-384 / AF70). GN=P034_00483320 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MATHTGARRAGRSPLIFFAMLSYLMMIPGVLAMNFVSRAEWKARAPKEGYKPMTDAKGVK
VHYLGPQFSGKQHSECDDFMRSVQNQHMDESPEDYFDIAYNLAVCEHGYVFDGRGKGHRS
GANGDVQLNSDHYAVLAFLGKSGVTEPTKEQIIGLQDSIAYLRRAGAGDEIKGHRDGYNT
ECPGDPLYKLVTDGSLDPGNLWDGGSHTVQKGEDLDTISAKYNVPKQYIITANDLQSPYR
LTVNQTIEIPARGVPLTESRN
Download sequence
Identical sequences A0A0D9N0J9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]