SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D9NJB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9NJB1
Domain Number 1 Region: 333-519
Classification Level Classification E-value
Superfamily MIR domain 3.53e-51
Family MIR domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D9NJB1
Sequence length 765
Comment (tr|A0A0D9NJB1|A0A0D9NJB1_METAN) Dolichyl-phosphate-mannose-protein mannosyltransferase {ECO:0000313|EMBL:KJK73823.1} KW=Complete proteome; Reference proteome OX=1291518 OS=Metarhizium anisopliae BRIP 53293. GN=H634G_10893 OC=Metarhizium.
Sequence
MARSQTPQGSLRQRNVGSKKADSSTSAVDVELDKLAKASIKKNASNCERDHWAAFSLTTI
LAFVTRFWGISHPNEVVFDEVHFGKFASYYLERTYFFDVHPPFAKLLFAFMGWLVGYDGH
FHFENIGDSYIDNKVPYVAFRALPAILGALTVSVTYLIMWESGYSVPACLIAAGLVLFDN
AHIGQTRLILLDATLVLAMACSLLFYIKFYKLRHEPFSRKWWKWLILTGFALSCDMSTKY
VGTFAFVTIGAAVIIDLWDLLDIKRPGGAISLPQFGRHFAARAVGLIILPFLFYLFWFQV
HFAVLSRSGPGDDFMSPEFQETLSDNAMLANAVDIQYYDTITIKHKETKAFLHSHPHQYP
LRYDDGRVSSQGQQVTGYPHNDTNNYWQILPSSDDKQMGRKVKNNELIRLRHVGTDTVLL
SHDVASPYYPTNQEFTTVSQDDAYGSRVNDTLFEIRIENGKNGQEFKTIASYFKLIHFPS
KVAMWTHTKPLPEWGSHQQEINGNKQIAPSSNIWLVEDIASLAADDARREKPERKVKTLP
FLRKWFELQRAMFYHNSKLTSSHPYASHPYQWPFLLRGVSFWTQNDTRQQIYFLGNPIGW
WLASSLLAVYIGIVLADQISLRRGIDALDHRTRSRLYNSTGFFWVAWATHYFPFFVMGRQ
LFLHHYLPAHLASCLVAGALIEFVFSAEPVDETRGPRKSPKKHLTARERLAGQSMMGAWI
ACGVVLTIVIAGWWFFLPLTYGYPGLSVEQVVRRKWLGYDLHFAK
Download sequence
Identical sequences A0A0D9NJB1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]