SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D9NKY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9NKY6
Domain Number 1 Region: 685-908
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.46e-65
Family NADPH-cytochrome p450 reductase FAD-binding domain-like 0.0013
Further Details:      
 
Domain Number 2 Region: 910-1070
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 4.32e-36
Family NADPH-cytochrome p450 reductase-like 0.00095
Further Details:      
 
Domain Number 3 Region: 427-668
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.7e-25
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0014
Further Details:      
 
Domain Number 4 Region: 280-440
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.09e-24
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D9NKY6
Sequence length 1070
Comment (tr|A0A0D9NKY6|A0A0D9NKY6_METAN) Sulfite reductase flavoprotein component {ECO:0000313|EMBL:KJK74531.1} KW=Complete proteome; Reference proteome OX=1291518 OS=Metarhizium anisopliae BRIP 53293. GN=H634G_10164 OC=Metarhizium.
Sequence
MRSQPQESTGGAVPPQKTNPSDFEILSSALPFGQPVPLDAISGPTYVTAQLLVQQIAYKL
SDKIFSYSPETFELDVAAKNWAAKQNTNIHGYAPQVLPLQTRTGAGALALGYIFSPDFDV
SRRHIPQTLLAPSGSLQQLRGTLDQLSLLYSVSSPFVAHVAAADYTDADGLVSNYDTALR
LAEDLGLGLVSSSSTYEAQHMSLFSTLLATVLPTIHVYDGIRVARETLRVVDALSESGVA
DVYNKLVSEAGKLNSHLDTAGKVVELLKLFNDELGTVYQPFEYHGHETPDVVLVAFGSVE
TQVAKQTLNKIAADGAKVGVINVRVYRPFIEEEFLKSIPASARTIAVLGQVRDHVAVADD
ATQSALYGDVLAAVTFSGKFGEEPRVLDIKYTPAQSLTPQGLVNTLHKVFGNEDEAKTLP
SLVNAEQYTFWDVDNSAAVNSPAVIGHILSKQSTTNVYVHATYDNLTQGGVVRTDVRASR
KALEAPYDVYEADVAVIGDDCVLKDVNVVESVAHGGKIILKLPNFKVEEVEKRLSAAFRK
AVQEKDAQLFVLDTSFSPAFEKDAQSKLLLELAFLRVAQPELSPEIISKLVLVEGHPPTL
EECVEAVNQCLSKLEVPATWAEVADNFEAPQLPISLQSNSFVPFQKEDVEEALELRDWQT
AAKGLVFKEVYETRTGLRPDLPVKTATIRVKENRRLTPSDYDRNIFHIEFDLGDSGLTYK
IGEALGIHAENDEEQVSAFIQAYGLNPAELARVPAREDLEALEIRTVHQALIQNVDILGK
PPKRFYEALAEFATDETERKKLEALGSSAGAEDFKRRSEVDMLTYVDVLDEFKSARPSFN
DLVRMVSPLKRREYSIASAQAVTPNSVALMIVVVDWVDTKGRTRYGHATRYLSRLQPGAV
VTASVKPSVMKLPTKDTAPLIMAGLGTGLAPFRAFVQYRAMQKAQGKEIGAILLYLGSRH
QREEYLYGEEWEAYLAAGVVTLIGAAFSRDQPQKIYIQDRMRQTLGDIAKAYVQDEGSFY
LCGPTWPVPDVTKVLEEAIAADAKASGKKVDPKKEIEKLKEEGRYVLEVY
Download sequence
Identical sequences A0A0D9NKY6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]