SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D9NPE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9NPE8
Domain Number 1 Region: 331-531
Classification Level Classification E-value
Superfamily MIR domain 3.31e-55
Family MIR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D9NPE8
Sequence length 934
Comment (tr|A0A0D9NPE8|A0A0D9NPE8_METAN) Uncharacterized protein {ECO:0000313|EMBL:KJK74490.1} KW=Complete proteome; Reference proteome OX=1291518 OS=Metarhizium anisopliae BRIP 53293. GN=H634G_10187 OC=Metarhizium.
Sequence
MARSSSARGKSPQPPTVTATTTKSKAKSTSYKSDGVEDNDIFLLPASDYVVSLLLTLLAA
IVRVFRIYQPSSVVFDEVHFGGFASKYIKGKFFMDVHPPLAKMLIALTGWLAGFDGNFDF
KEIGKDYLEPGVPYVSMRLFPAICGILLVPCMFFTLKVVGCRTMTAAMGASLIIFENGLL
TQARLILLDSPLVAATAFTALAFSCFTNQHELGPAKAFQPAWWFWLAMTGLGLGITVSIK
WVGLFTIAWVGALTLLQLWVLLGDNKNVTMRLWSKHLMARAFCLIIIPITFYMAMFAIHF
LCLVNPGDGDGFMSSEFQATLNNKGMNDVAADVAFGSRVSIRHVNTQGGYLHSHPLMYPT
GSKQQQITLYPHKDENNVWLLENQTQPLGVDGQPLNGTHVWDNLPDGPVFIEDGAVLRLY
HTPTFRRLHSHDVRPPITEADWQNEVSAYGYEGFEGDANDYFRVEIVKKQSHGAVAKERL
RTIETKFRLVHVMTGCVLFSHKVKLPDWASEQQEVTCARGGSVPNSLWYIEHNEHPQHDE
NTPKVNYRNPGFFGKFLELQQVMWTTNAGLTESHAWDSRPESWPILRRGINFWGKNHTQI
YLIGNPIIWWASSITIVVWVLFKGVAILRWQRSCNDYANPTFKRFDYELGTSILGWALHY
FPFYLMQRQLFLHHYFPALYFAIIALSQLFDFLTVRFPGVKSKDAAIVNKTATMLFLVLS
IAVFSLLAPLAYGNSWTKDDCKRVKLFNTWDWDCNNFFDRYDQYTSLGSGDPSSSASDIP
SIPSSPVPAGEEEQHKSVVDDAGVSDKPEPSAKILSQEEKIEYRDQDGNLLDDEQVKKLQ
GKVKFETKYETRTRVVDEQGNELPAPDGGWPSDMVAGVAPPHPDVHGVDQETVKGEHAEA
PKDAAASRDGEKEAERSKAKPASEGQEATVRDEL
Download sequence
Identical sequences A0A0B4F5E1 A0A0D9NPE8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]