SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D9QE95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9QE95
Domain Number 1 Region: 5-299
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.23e-67
Family Capz alpha-1 subunit 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D9QE95
Sequence length 305
Comment (tr|A0A0D9QE95|A0A0D9QE95_PLAFR) Uncharacterized protein {ECO:0000313|EMBL:KJP85323.1} KW=Complete proteome; Reference proteome OX=5857 OS=Plasmodium fragile. GN=AK88_05025 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MESLLNEKKNFIRHVLMHAPPGNLADLVSDLKTLFGTSAAIQNTIEEAVAAHNEKNYAII
PLSGDDYVITCEESKVGNSYLQPKLKSLLDVNHLKKKVNTTADVEEVRYPDLLENYRNSC
SAKLEEYVQVHYSNWNELQTINYPTVNINSKNGLSVKCCSSVYAKEHEGRFNLLFVVCCD
RHYLKNFHASSWRSSWNVTFLTTDEEVLLNGTIDIVLTYFEDANINFKATKRFEKRVHVN
SAVDNFSANIVSAIRECENSALYELNEFLIHIDKELIKNTRKIMPFNGDKFDWKETYHDI
PSQIK
Download sequence
Identical sequences A0A0D9QE95
XP_012338052.1.82741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]