SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9R416 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9R416
Domain Number 1 Region: 28-95
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 7.21e-24
Family Interleukin 8-like chemokines 0.0000573
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D9R416
Sequence length 96
Comment (tr|A0A0D9R416|A0A0D9R416_CHLSB) C-C motif chemokine {ECO:0000256|RuleBase:RU361150} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=CCL20 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MCYSKSLLLAALMSVLLLHLCSESEAASNFDCCLRYTDRILHPKFIVGFTQQLANETCDI
NAVIFHTKKGLSVCANPKQTWVKLIVRRLSKKINKM
Download sequence
Identical sequences A0A0D9R416
XP_007964706.1.81039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]