SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D9R4C9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9R4C9
Domain Number 1 Region: 24-194
Classification Level Classification E-value
Superfamily MIR domain 1.15e-58
Family MIR domain 0.00000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D9R4C9
Sequence length 211
Comment (tr|A0A0D9R4C9|A0A0D9R4C9_CHLSB) Stromal cell derived factor 2 {ECO:0000313|Ensembl:ENSCSAP00000003468} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=SDF2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MAVVRLLLLGGLWSAVGASSLAVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGV
TSVDDSNSYWRIRGKTATVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQEVSA
FGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMA
QPSQNNYWKAMEGIFMKPSELLKAEAHHAEL
Download sequence
Identical sequences A0A0D9R4C9
XP_008008999.1.81039 XP_008009000.1.81039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]