SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0D9R5R7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9R5R7
Domain Number 1 Region: 236-433
Classification Level Classification E-value
Superfamily MIR domain 1.13e-63
Family MIR domain 0.0000000688
Further Details:      
 
Domain Number 2 Region: 435-601
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 4.18e-55
Family IP3 receptor type 1 binding core, domain 2 0.000000261
Further Details:      
 
Domain Number 3 Region: 1161-1280
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.7e-34
Family IP3 receptor type 1 binding core, domain 2 0.01
Further Details:      
 
Domain Number 4 Region: 106-218
Classification Level Classification E-value
Superfamily MIR domain 1.7e-20
Family MIR domain 0.017
Further Details:      
 
Domain Number 5 Region: 1232-1322,1418-1686,1915-2055
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000664
Family HspBP1 domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D9R5R7
Sequence length 2700
Comment (tr|A0A0D9R5R7|A0A0D9R5R7_CHLSB) Inositol 1,4,5-trisphosphate receptor type 2 {ECO:0000313|Ensembl:ENSCSAP00000003956} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=ITPR2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MTDKMSSFLYIGDIVSLYAEGSVNGFISTLGLVDDRCVVHPEAGDLANPPKKFRDCLFKV
CPMNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQNESENKKLLGEIVKYSNV
IQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIHPFWKLRSEGDNIVVGD
KVVLMPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKITLFMKYSSYREDVLKGGDVV
RLFHAEQEKFLTCDEYEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRGGAGQWN
SLFRFKHLATGNYLAAELNPDYRDAQNEGKNVRDDHPTSKKKRQAGEKIMYTLVSVPHGN
DIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTSIPIDTDEERPVMLKIGTCQ
TKEDKEAFAIVSVPLSEVRDLDFANDANKVLATTVKKLENGTITQNERRFVTKLLEDLIF
FVADVPNNGQEVLDVVITKPNRERQKLMREQNILAQVFGILKAPFKEKAGEGSMLRLEDL
GDQRYAPYKYMLRLCYRVLRHSQQDYRKNQEYIAKNFCVMQSQIGYDILAEDTITALLHN
NRKLLEKHITAKEIETFVSLLRRNREPRFLDYLSDLCVSNTTAIPVTQELICKFMLSPGN
ADILIQTKVVSMQADNPMESSILSDDIDDEEVWLYWIDSNREPHGKAIRHLAQEAKEGTK
ADLEVLTYYRYQLNLFARMCLDRQYLAINQISTQLSVDLILRCVSDESLPFDLRASFCRL
MLHMHVDRDPQESVVPVRYARLWTEIPTKITIHEYDSITDSSRNDMKRKFALTMEFVEEY
LKEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQAPMS
SYFERLSKFQDGGNNVMRTIHGVGEMMTQMVLSRGSIFPMSVPDVPPSIHPSKQGSPAEH
EDVTVMDTKLKIIEILQFILSVRLDYRISYMLSIYKKEFGEDNDNAETSANGSPDTLLPS
AIVPDIDEIAAQAETMFAGRKEKNPVQLDDEGGRTFLRVLIHLIMHDYPPLLSGALQLLF
KHFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSSNYENGEI
GESQVKGGEEPIEESNILSPVQDGTKKPQIDSNKSNNYRIVKEILIRLSKLCVQNKKCRI
QHQRLLKNMGAHSVVLDLLQIPYEKNDEKMNEVMNLAHTFLQNFCRGNPQNQVLLHKHLN
LFLTPGLLEAETMRHIFMNNYHLCNEISERVVQHFVHCIETHGRHVEYLRFLQTIVKADG
KYVKKCQDMVMTELINGGEDVLIFYNDRASFPILLHMMCSERDRGDESGPLAYHITLVEL
LAACTEGKNVYTEIKCNSLLPLDDIVRVVTHDDCIPEVKIAYVNFVNHCYVDTEVEMKEI
YTSNHIWKLFENFLVDMARVCNTTTDRKHADIFLEKCVTESIMNIVSGFFNSPFSDNSTS
LQTHQPVFIQLLQSAFRIYNCTWPNPSQKASVESCIRTLAEVAKNRGIAIPVDLDGQVNT
LFMKSHSNMVQRAAMGWRLSARSGPRFKEALGGPSWDYRNIIEKLQDVVASLEHQFSPMM
QAEFSVLVDVLYSPELLFPEGSDARIRCGAFMSKLINHTKKLMEKEEKLCIKILQTLREM
LEKKDSFVEEGNTLRKILLNRYFKGDYSIGMNGHLSGAYSKTAQVGGSFSGQDSDKMGIS
MSDIQCLLDKEGASELVIDVIVNTKNDRIFSEGIFLGIALLEGGNTQTQYSFYQQLHEQK
KSEKFFKVLYDRMKAAQKEIRSTVTVNTIDLGSKKRDDDNELMTSGPRMRVRDSTLHLKE
GMKGQLTEASSATSKAYCVYRREMDPEIDIMCTGPEAGNTEEKSAEEVTMSPAIAIMQPI
LRFLQLLCENHNRELQNFLRNQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKN
VALVNQTLESLTEYCQGPCHENQTCIATHESNGIDIIIALILNDINPLGKYRMDLVLQLK
NNASKLLLAIMESRHDSENAERILFNMRPRELVDVMKNAYNQGLECDHGDDEGGDDGVSP
KDVGHNIYILAHQLARHNKLLQQMLKPGSDPDEGDEALKYYANHTAQIEIVRHDRTMEQI
VFPVPNICEYLTRESKCRVFNTTERDEQGSKVNDFFQQTEDLYNEMKWQKKIRNNPALFW
FSRHISLWGSISFNLAVFINLAVALFYPFGDDGDEGTLSPLFSVLLWIAVAICTSMLFFF
SKPVGIRPFLVSIMLRSIYTIGLGPTLILLGAANLCNKIVFLVSFVGNRGTFTRGYRAVI
LDMAFLYHVAYVLVCMLGLFVHEFFYSFLLFDLVYREETLLNVIKSVTRNGRSIILTAVL
ALILVYLFSIIGFLFLKDDFTMEVDRLKNRTPVTGSHQVPTMTLTTMMEACARENCSPTI
PASNTADEEYEDGIERTCDTLLMCIVTVLNQGLRNGGGVGDVLRRPSKDEPLFAARVVYD
LLFYFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEE
HIKSEHNMWHYLYFIVLVKVKDPTEYTGPESYVAQMIVEKNLDWFPRMRAMSLVSNEGDS
EQNEIRNLQEKLESTMSLVKQLSGQLAELKEQMTEQRKNKQRLGFLGSNTPHVNHHMPPH
Download sequence
Identical sequences A0A0D9R5R7
XP_007966183.1.81039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]