SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D9RCU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D9RCU0
Domain Number 1 Region: 24-198
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 5.12e-61
Family Crystallins/Ca-binding development proteins 0.0000364
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D9RCU0
Sequence length 211
Comment (tr|A0A0D9RCU0|A0A0D9RCU0_CHLSB) Crystallin beta B3 {ECO:0000313|Ensembl:ENSCSAP00000006429} KW=Complete proteome; Reference proteome OX=60711 OS=Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus). GN=CRYBB3 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Chlorocebus.
Sequence
MAEQHGAPEQAAAGKSHGGLGGSYKVIVYELENFQGKRCELSAECPSLTDSLLEKVGSIQ
VESGPWLGFESRAFRGEQFVLEKGDYPRWDAWSNSRNSDSLLSLRPVNIDSPDHKLHLFE
NPAFSGRKMEIVDDDVPSLWAHGFQDRVASVRAINGTWVGYEFPGYRGRQYVFERGEYRH
WNEWNASQPQLQSVRRIRDQKWHKRGCFLSS
Download sequence
Identical sequences A0A0D9RCU0
XP_007973401.1.81039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]