SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E0AT72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0AT72
Domain Number 1 Region: 131-304
Classification Level Classification E-value
Superfamily MIR domain 4.32e-58
Family MIR domain 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E0AT72
Sequence length 313
Comment (tr|A0A0E0AT72|A0A0E0AT72_9ORYZ) Uncharacterized protein {ECO:0000313|EnsemblPlants:OGLUM08G09380.1} KW=Complete proteome; Reference proteome OX=40148 OS=Oryza glumipatula. GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MSLMSRPRGEPSRSFRAGALPSNEAAAVAPPATQPSQGLSRRSRAGPGERQQPGEAASLA
VALARERIRRSGEAEGEEEGPVPFWQRTWFLALLLAMAAASFAIALLLYLGLDLPEASPA
QSYAADPDNVVEITYGSAIKLMHERTKFRLHSHDVPYGSGSGQQSVTSFPNVDDSNSYWI
VRPQPDTSAKQGDPITHGTVVRLQHMRTRKWLHSHMHASPITGNLEVSCFGGENESDTGD
YWRLEIEGSGKSWRQNQKIRLRHVDTGGYLHSHDRKYTRIAGGQQEVCGVGDKRPDNVWL
AAEGVYLPVNQQK
Download sequence
Identical sequences A0A0D3GYC7 A0A0E0AT72 A0A0E0QGQ4
OGLUM08G09380.1 OBART08G08780.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]