SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0E0AVW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0AVW8
Domain Number 1 Region: 33-208
Classification Level Classification E-value
Superfamily MIR domain 3.53e-60
Family MIR domain 0.0000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E0AVW8
Sequence length 217
Comment (tr|A0A0E0AVW8|A0A0E0AVW8_9ORYZ) Uncharacterized protein {ECO:0000313|EnsemblPlants:OGLUM08G16910.1} KW=Complete proteome; Reference proteome OX=40148 OS=Oryza glumipatula. GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MAASVLALAVAFLLGASGYGVDRGAAAASPAAEGVEVAYGSTIKLMHEKTKHRLHSHDVP
YGSGSGQQSVTGFPEVDDSNSYWIVRPSPDSSAKQGDAIETGSIIRLQHMRTRKWLHSHL
HASPLSGNLEVSCFGGDGQSDTGDYWRLEIEGGGKLWKQDQKVRLRHVDTGGYLHSHNKK
YNRLGGGQQEVCGVREKRAENIWLATEGVYLPVNKSK
Download sequence
Identical sequences A0A0D3H0Q4 A0A0E0AVW8 A0A0E0EM05 A0A0E0ICI4 A2YVL8 I1QJ06 Q6Z9G2
39946.BGIOSIBCE028002 39947.LOC_Os08g34190.1 ONIVA08G17670.1 OMERI08G13060.1 XP_015648496.1.37577 ORGLA08G0140700.1 OGLUM08G16910.1 OsIBCD026651 LOC_Os08g34190.1|13108.m03576|protein OBART08G16110.1 LOC_Os08g34190.1|PACid:21887354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]