SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0FA18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0FA18
Domain Number 1 Region: 5-250
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.13e-79
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0E0FA18
Sequence length 256
Comment (tr|A0A0E0FA18|A0A0E0FA18_9ORYZ) Uncharacterized protein {ECO:0000313|EnsemblPlants:OMERI12G02740.3} KW=Complete proteome; Reference proteome OX=40149 OS=Oryza meridionalis. GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MRSSNEARNAANREKNRYIDVVPFDTTRVRLKRSTTSQTSSNDYINASFIKVTEDNRVAK
FISTQGPLAKTFDDFWEMVYEYQCPVIVMLTQFDSLKCDEYLPLRKQPEAYGKYNVKITN
AKRDSHQLWLRDVMVQCNESSRVHSVRHIEYPDWPDHGVPTNTDAVRQIRKWLQNTPMEH
PIVVHCSAGIGRTGAYITIHSTIERLLLGDKSSYHLDETVKTLRTQRVGMVQTEKQYMFC
YRAIADELKDLLESNR
Download sequence
Identical sequences A0A0E0FA18

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]