SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0E0GDY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0E0GDY9
Domain Number 1 Region: 4-100
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 3.14e-29
Family Steroid-binding domain 0.0000491
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0E0GDY9
Sequence length 102
Comment (tr|A0A0E0GDY9|A0A0E0GDY9_ORYNI) Uncharacterized protein {ECO:0000313|EnsemblPlants:ONIVA02G37740.1} KW=Complete proteome; Reference proteome OX=4536 OS=Oryza nivara (Indian wild rice). GN= OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MAAELTAAQLRAYDGSDPSKPIYVSVRGKVYDVTSGRGFYGPGGAYAVFAGREASRALGK
MSKDDADVSGDLSGLSDKELGVLADWETKFQAKYPVVARLTE
Download sequence
Identical sequences A0A0D9YZJ9 A0A0E0GDY9 A0A0E0NM18 A2XAH7 Q6K680
ONIVA02G37740.1 LOC_Os02g55060.1|13102.m06307|protein LOC_Os02g55060.2|13102.m06306|protein OsIBCD038332 39946.BGIOSIBCE008952 39947.LOC_Os02g55060.1 OGLUM02G36870.1 LOC_Os02g55060.1|PACid:21923146 LOC_Os02g55060.2|PACid:21923147 XP_015623047.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]